PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 279aa    MW: 32483.5 Da    PI: 8.0072
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37941.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W  eEd+ll ++v ++G g+W+++a+  g++R++k+c++rw +yl
       KHN37941.1 16 KGPWIGEEDKLLCEYVSLHGEGRWSSVAKLTGLNRSGKSCRLRWVNYL 63
                     789999****************************************97 PP

2Myb_DNA-binding50.74.2e-1673113547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      T+ E+e ++++++ lG++ W+tIa++++ gRt++++k++w+++
       KHN37941.1  73 TPREEEMIIELHAILGNK-WSTIAKYLP-GRTDNEIKNYWRTH 113
                      999***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-211166IPR009057Homeodomain-like
PROSITE profilePS5129422.581167IPR017930Myb domain
SuperFamilySSF466898.98E-3014110IPR009057Homeodomain-like
SMARTSM007171.4E-131565IPR001005SANT/Myb domain
PfamPF002492.2E-151663IPR001005SANT/Myb domain
CDDcd001679.40E-101863No hitNo description
Gene3DG3DSA:1.10.10.606.3E-2367115IPR009057Homeodomain-like
SMARTSM007174.0E-1368116IPR001005SANT/Myb domain
PROSITE profilePS5129418.04268118IPR017930Myb domain
PfamPF002493.3E-1473113IPR001005SANT/Myb domain
CDDcd001672.68E-1173113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MVAMKGSLAT QKEWRKGPWI GEEDKLLCEY VSLHGEGRWS SVAKLTGLNR SGKSCRLRWV  60
NYLRPGLKKA QLTPREEEMI IELHAILGNK WSTIAKYLPG RTDNEIKNYW RTHSGKRERS  120
KHNKKLQRPK VKNVLKQLKQ KQQHEQQPQE YDIKSSMSHE ETENETKSFH TQNNNQQEIL  180
EMGFMYPTTI EHQYTVPSMH DGFSSTWQDT LADDGSWFSL WDFDEPQGFS DYVDQFGKCA  240
MPNQTSFGAG GDYSMQNHVK TSCFVDTYDS LFYGKDMFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261611027120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0991000.0BT099100.1 Soybean clone JCVI-FLGm-16H10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551774.20.0PREDICTED: myb-related protein 340-like
TrEMBLA0A0B2RU400.0A0A0B2RU40_GLYSO; Transcription factor MYB59
TrEMBLK7MV200.0K7MV20_SOYBN; Uncharacterized protein
STRINGGLYMA18G50881.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.13e-58myb domain protein 121
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]